DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:212 Identity:69/212 - (32%)
Similarity:102/212 - (48%) Gaps:46/212 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 SADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALAD 140
            :.|||:.......:....::    :|.|..||..:::.|:.|:.|:..:....::...||     
Zfish     8 AGDYTLGANEGTEQYSKPLM----LIPHPLYNRSTNNADIMLIKLSAPIELNRYVSLAPL----- 63

  Fly   141 PPTADTRL------QVSGWGFQAEESAVSGEVGVSP-QLRFVDVDLVESNQCRRAYSQVLPITRR 198
             |..:|.|      :|||||      :.|...|:.| .||.|.:.:|.:.:|..:.|....||..
Zfish    64 -PKQNTGLLAGRMCRVSGWG------STSHSGGLIPLTLRTVRLPIVSTFKCNSSSSFSGNITAN 121

  Fly   199 MICA--ARPGRDS---------------CQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFP 246
            ||||  :..|:|:               ||||||||||      ...|:||:||||.||.:|.||
Zfish   122 MICAGSSTGGKDACKNSTQYLCHLIVYLCQGDSGGPLV------CDGRVYGLVSWGNGCGDPRFP 180

  Fly   247 GVYTNVAAFRSWIDEQL 263
            ||||.|:.||.|||:.:
Zfish   181 GVYTAVSRFRRWIDQTI 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 66/206 (32%)
Tryp_SPc 28..262 CDD:238113 69/209 (33%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 69/209 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.