DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and PRSS3

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:254 Identity:86/254 - (33%)
Similarity:123/254 - (48%) Gaps:30/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRV 83
            |.|...|.:||||........|||||:. .|.|.|||::|....|::||||::     ....||:
Human   101 AVPFDDDDKIVGGYTCEENSLPYQVSLN-SGSHFCGGSLISEQWVVSAAHCYK-----TRIQVRL 159

  Fly    84 GSSEH-----ESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPT 143
            |  ||     |.....::..::|.|..||..:.|||:.|:.|:........:..:.|.  ..||.
Human   160 G--EHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLP--TTPPA 220

  Fly   144 ADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICAA--RPG 206
            |.|...:||||     :.:|.......:|:.:|..::...:|:.:|..  .||..|.|..  ..|
Human   221 AGTECLISGWG-----NTLSFGADYPDELKCLDAPVLTQAECKASYPG--KITNSMFCVGFLEGG 278

  Fly   207 RDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQLDA 265
            :||||.|||||:|      ...:|.|:||||.|||..|.|||||.|..:..||.:.:.|
Human   279 KDSCQRDSGGPVV------CNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAA 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 80/238 (34%)
Tryp_SPc 28..262 CDD:238113 82/240 (34%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 80/238 (34%)
Tryp_SPc 110..328 CDD:238113 82/240 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.