DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Cma2

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001019885.1 Gene:Cma2 / 545055 MGIID:88426 Length:246 Species:Mus musculus


Alignment Length:273 Identity:81/273 - (29%)
Similarity:120/273 - (43%) Gaps:43/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LWWLMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRH----ICGGAIIGIDTVLTAA 67
            |.:||||:..:.|    |...|:||..:.....||...|....|.    ||||.:|....|:|||
Mouse     4 LLFLMALLLPSRA----GAEEIIGGVESEPHSRPYMAYVNTFRRKGYVAICGGFLITPQFVMTAA 64

  Fly    68 HCFEDPWSSADYTVRVGS---SEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEH 129
            ||     |....||.:|:   .:.|.....:.:.:.|...:||..|..||:.||.|..|.|.|..
Mouse    65 HC-----SGRRMTVTLGAHNVRKRECTQQKIKVEKYILPPNYNVSSKFNDIVLLKLKKQANLTSA 124

  Fly   130 LQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCR--RAYSQV 192
            :..|||.|.:|.....|....:|||....:.:      :|..||.|::.::....|:  :.|...
Mouse   125 VDVVPLPAPSDFAKPGTMCWAAGWGRTGLKKS------ISRTLREVELRIMGKKACKIFKHYKDS 183

  Fly   193 LPITRRMICAARPGRDSC--QGDSGGPLV--GYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVA 253
            |     .||.....:.:.  .|||||||:  |.|        :||||.|.|.|.|  |.::|.::
Mouse   184 L-----QICVGSSTKVASVYMGDSGGPLLCAGVA--------HGIVSSGRGNAKP--PAIFTRIS 233

  Fly   254 AFRSWIDEQLDAR 266
            ....||:..::.:
Mouse   234 PHVPWINRVIEGK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 72/244 (30%)
Tryp_SPc 28..262 CDD:238113 74/246 (30%)
Cma2NP_001019885.1 Tryp_SPc 20..239 CDD:214473 72/244 (30%)
Tryp_SPc 21..242 CDD:238113 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.