DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Tpsab1

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:267 Identity:94/267 - (35%)
Similarity:138/267 - (51%) Gaps:30/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQG---RHICGGAIIGIDTVLTAAHCFE 71
            |.:||..|.:...|.:| ||||:.|:..::|:|||:::..   .|.|||::|....|||||||. 
  Rat    49 LSSLVHAAPSLAMPREG-IVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIHPQWVLTAAHCV- 111

  Fly    72 DPWSSADYTVRVGSSE-----HESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQ 131
            .|..:....:||...:     |:   |:|::.::|:|.|:.......|:|||.|...:|.|.::.
  Rat   112 GPNKADPNKLRVQLRKQYLYYHD---HLLTVSQIISHPDFYIAQDGADIALLKLTNPVNITSNVH 173

  Fly   132 PVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSP--QLRFVDVDLVESNQCRRAYSQVLP 194
            .|.|...::...:.|...|:|||      .::.:|.:.|  .|..|.|.:||:..|...|.:.|.
  Rat   174 TVSLPPASETFPSGTLCWVTGWG------NINNDVSLPPPFPLEEVQVPIVENRLCDLKYHKGLN 232

  Fly   195 -------ITRRMICAARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNV 252
                   :...|:||...|.||||||||||||  ...|......|:||||.|||.||.||:||.|
  Rat   233 TGDNVHIVRDDMLCAGNEGHDSCQGDSGGPLV--CKVEDTWLQAGVVSWGEGCAQPNRPGIYTRV 295

  Fly   253 AAFRSWI 259
            ..:..||
  Rat   296 TYYLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 86/248 (35%)
Tryp_SPc 28..262 CDD:238113 88/249 (35%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 86/247 (35%)
Tryp_SPc 66..302 CDD:238113 86/247 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.