DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Mcpt10

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_058842.2 Gene:Mcpt10 / 54269 RGDID:3063 Length:248 Species:Rattus norvegicus


Alignment Length:269 Identity:74/269 - (27%)
Similarity:126/269 - (46%) Gaps:41/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLWWLMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQL----QGRHICGGAIIGIDTVLTA 66
            ||::|:|::    ...|.| |.|:.|..:.....||..|:..    ..||.|||.::..|.|:||
  Rat     4 FLFFLVAIL----PVNTEG-GEIIWGTESKPHSRPYMASLMFYYGNSYRHYCGGFLVAKDIVMTA 63

  Fly    67 AHCFEDPWSSADYTVRVGSS--EHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEH 129
            |||     :.::..|.:|:.  :.:....|:::.:...|.:|:..|..||:.||.|..:......
  Rat    64 AHC-----NGSNIKVTLGAHNIKKQEKTQVIAVVKAKPHENYDRHSRFNDIMLLKLERKAQLNGA 123

  Fly   130 LQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCR---RAYSQ 191
            ::.:.|....|.........|:|||..|..|       :|..|:.|::::.|..:|.   |.|:.
  Rat   124 VKTIALPRSQDWVKPGQVCTVAGWGCLANCS-------LSNTLQEVNLEVQEGQKCEDMSRNYND 181

  Fly   192 VLPITRRMICAARP--GRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAA 254
            .:     .:|...|  |:.:.:||||||.|.    :|.|:  ||||:.| |.. ..|.|:|.:::
  Rat   182 SI-----QLCVGNPSEGKATGKGDSGGPFVC----DGVAQ--GIVSYRL-CTG-TLPRVFTRISS 233

  Fly   255 FRSWIDEQL 263
            |..||.:.:
  Rat   234 FIPWIQKTM 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 65/242 (27%)
Tryp_SPc 28..262 CDD:238113 67/244 (27%)
Mcpt10NP_058842.2 Tryp_SPc 21..241 CDD:238113 67/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.