DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and prss1.2

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001011251.1 Gene:prss1.2 / 496697 XenbaseID:XB-GENE-6083469 Length:249 Species:Xenopus tropicalis


Alignment Length:265 Identity:83/265 - (31%)
Similarity:129/265 - (48%) Gaps:31/265 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WLMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDP 73
            |::..:|.|.|.|. .|.:||||...|....|:||......:..|||:::....:::||||:..|
 Frog     5 WILLFLAVAAAAPL-DDDKIVGGYECTPHSQPWQVYFTQNSQVFCGGSLVTPRWIISAAHCYRPP 68

  Fly    74 ------WSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQP 132
                  ....|.|...|:.:|      :.:.....|..|..:::|:|:.|:.|.....:.:::||
 Frog    69 KTLVAHLGDHDLTKEEGTEQH------IQVEAAYKHSSYKDEAYDHDIMLVKLAKPAQYNQYVQP 127

  Fly   133 VPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSP-QLRFVDVDLVESNQCRRAYSQVLPIT 196
            :|:|...  |...|...|||:|     :..|..:|..| :|:.|||.::..:.|:.:...:  .|
 Frog   128 IPVARSC--PREGTECLVSGYG-----NLRSDHIGEFPDRLQCVDVPVLSDSSCKASCRGL--FT 183

  Fly   197 RRMICAA--RPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWI 259
            ..|.||.  ..|:||||.|||||||      ....|||:||||.|||..|.||||..|..:..|:
 Frog   184 ENMFCAGFLEGGKDSCQVDSGGPLV------CNGELYGVVSWGWGCAQRNAPGVYAKVCNYLRWV 242

  Fly   260 DEQLD 264
            ...::
 Frog   243 QNIIE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 76/240 (32%)
Tryp_SPc 28..262 CDD:238113 77/242 (32%)
prss1.2NP_001011251.1 Tryp_SPc 23..245 CDD:238113 77/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.