DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and prss27

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_031749235.1 Gene:prss27 / 496619 XenbaseID:XB-GENE-5744470 Length:724 Species:Xenopus tropicalis


Alignment Length:274 Identity:94/274 - (34%)
Similarity:145/274 - (52%) Gaps:30/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MALVAYAGATPTPGDG------RIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHC 69
            :.|..:|....:.|.|      |||||..|...|:|:|||:..|..|||||:::..:.|::||||
 Frog   397 LLLAGFAVTAISTGCGQPAFSDRIVGGNNAVFGEWPWQVSIVYQNSHICGGSLVSSNWVVSAAHC 461

  Fly    70 FEDPWSSADYTVRVGS---SEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQ 131
            |...:...:..|.:|.   ....|...::.::|||.:..|..:....|:|::.:...:.::.::.
 Frog   462 FPRSYKIENMQVLLGCFALMNLTSDAVIIRVKRVITYPLYTGEGSSGDIAMVEMESPVTYSSYIL 526

  Fly   132 PVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSP--QLRFVDVDLVESNQCRRAY---SQ 191
            |:.:....:...:.....|:|||      .:..:|.:||  .|:.|:|.||.::.|...|   |.
 Frog   527 PICIPLTNEDFPSGKMCWVTGWG------NIQSDVSLSPPYPLQEVEVPLVNASSCDTMYHYNSD 585

  Fly   192 VLPITR----RMICAARP--GRDSCQGDSGGPLVGYAAEEGPA-RLYGIVSWGLGCANPNFPGVY 249
            :.|.|:    .||||..|  .:|:|||||||||   |.:.|.. .|.||||||.|||.||.||||
 Frog   586 LNPATQLVHDDMICAGYPEGQKDACQGDSGGPL---ACKSGNYWFLTGIVSWGDGCAQPNRPGVY 647

  Fly   250 TNVAAFRSWIDEQL 263
            |.|::|.|||::.|
 Frog   648 TKVSSFSSWINQYL 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 87/246 (35%)
Tryp_SPc 28..262 CDD:238113 88/248 (35%)
prss27XP_031749235.1 Tryp_SPc 34..271 CDD:238113
Tryp_SPc 420..659 CDD:238113 88/247 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.