DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and deltaTry

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster


Alignment Length:261 Identity:106/261 - (40%)
Similarity:145/261 - (55%) Gaps:20/261 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KFLWWLMALVAYAGATPTPG-----DGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVL 64
            ||:..|.|:....|.|...|     |||||||...||..||:|:|:|..|.|.|||:|...:.::
  Fly     3 KFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIV 67

  Fly    65 TAAHCFEDPWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEH 129
            |||||.:.. |::...:|.|||...|||...|:.....|..||..:..||:|::.:||.|.|:..
  Fly    68 TAAHCLQSV-SASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSST 131

  Fly   130 LQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRA-YSQVL 193
            ::.:.||  :..|.......|||||     :...|...:..||::|:|::|..:||..: |....
  Fly   132 IKAIGLA--SSNPANGAAASVSGWG-----TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGS 189

  Fly   194 PITRRMICAARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSW 258
            .|...|||||..|:|:||||||||||....      |.|:||||.|||..|:||||.:|||.|||
  Fly   190 QIRSTMICAAASGKDACQGDSGGPLVSGGV------LVGVVSWGYGCAYSNYPGVYADVAALRSW 248

  Fly   259 I 259
            :
  Fly   249 V 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 96/232 (41%)
Tryp_SPc 28..262 CDD:238113 96/233 (41%)
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 96/232 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443280
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4288
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.