DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and KLK12

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:249 Identity:87/249 - (34%)
Similarity:115/249 - (46%) Gaps:47/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHI-CGGAIIGIDTVLTAAHCFEDPWSSADYTVR 82
            |||     :|..|........|:||.: .:|..: |||.:|....|||||||     |.:.|.||
Human    18 ATP-----KIFNGTECGRNSQPWQVGL-FEGTSLRCGGVLIDHRWVLTAAHC-----SGSRYWVR 71

  Fly    83 VGSSEHESGGHVLSLRRVIAHGDYN---------PQSHDNDLALLILNGQLNFTEHLQPVPLAAL 138
            :|  ||...  .|.....|.|..::         ..||::||.||.|...:..|..:||:||.  
Human    72 LG--EHSLS--QLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLP-- 130

  Fly   139 ADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLP--ITRRMIC 201
            .|..||.|...|||||..........::     |:.:::.:|....|...|    |  ||..|:|
Human   131 NDCATAGTECHVSGWGITNHPRNPFPDL-----LQCLNLSIVSHATCHGVY----PGRITSNMVC 186

  Fly   202 AAR-PGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWG-LG-CANPNFPGVYTNV 252
            |.. ||:|:||||||||||....      |.|:|||| :| |.....|||||.:
Human   187 AGGVPGQDACQGDSGGPLVCGGV------LQGLVSWGSVGPCGQDGIPGVYTYI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 84/241 (35%)
Tryp_SPc 28..262 CDD:238113 84/240 (35%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 84/241 (35%)
Tryp_SPc 22..236 CDD:238113 84/240 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.