DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG7829

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_651732.1 Gene:CG7829 / 43522 FlyBaseID:FBgn0039703 Length:253 Species:Drosophila melanogaster


Alignment Length:274 Identity:97/274 - (35%)
Similarity:144/274 - (52%) Gaps:35/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYSTKFLWWLMALVAYAG-----ATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGI 60
            ||.   |||.:.|:..:|     :.|.|   |||||..|.|...||.||:||.|.|.|||:||..
  Fly     2 MYK---LWWKLLLLQASGCLSLESRPDP---RIVGGFPADIANIPYIVSIQLYGIHHCGGSIINN 60

  Fly    61 DTVLTAAHCFED-PWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQL 124
            .|:|||.||... |.......|. |:|.:...|.:.|:..:..|.::||::.|.|:.::.|...|
  Fly    61 HTILTAGHCLNGVPHRLLKVKVG-GTSRYRKDGELFSVADLQVHENFNPKTMDYDIGIIRLTKNL 124

  Fly   125 NFTEHLQPVPLAALADPP--TADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRR 187
            ..:..::.:|:    :|.  ...|...::||||:    :::|.  .|..||:..|.:|....||.
  Fly   125 TLSRKVKAIPI----NPERVAEGTYATIAGWGFK----SMNGP--PSDSLRYARVPIVNQTACRN 179

  Fly   188 AYSQVLPITRRMICAA--RPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYT 250
            ...:.  :|.||:||.  :.|.|:||.||||||   :..|   :|.||||||:|||..:.||||:
  Fly   180 LLGKT--VTDRMLCAGYLKGGTDACQMDSGGPL---SVRE---QLVGIVSWGVGCALADKPGVYS 236

  Fly   251 NVAAFRSWIDEQLD 264
            .:.|...|:|:.|:
  Fly   237 RLDALHPWLDQVLN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 85/236 (36%)
Tryp_SPc 28..262 CDD:238113 86/238 (36%)
CG7829NP_651732.1 Tryp_SPc 27..244 CDD:214473 85/235 (36%)
Tryp_SPc 28..248 CDD:238113 86/238 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443357
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.