DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG34129

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster


Alignment Length:247 Identity:62/247 - (25%)
Similarity:104/247 - (42%) Gaps:53/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGSS----E 87
            ||:.|:                |...||.|......|:|:|:|.....:|.:.....|::    :
  Fly    58 RILNGD----------------GNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFSECD 106

  Fly    88 HESGGHVLSLR---RVIAHGDYNPQSHDNDLALLIL----NGQLNFTEHLQPVPLAALADPPTAD 145
            .|:...:.:::   :.|....|      .|:|::.|    .|:|  ||.::   |.::...|  .
  Fly   107 RENYADIDTIQFPEKFIYQKLY------MDVAVVRLRDPVRGRL--TEFIR---LCSVKVQP--K 158

  Fly   146 TRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICAARP-GRDS 209
            .::.|.||||...|..:.     |...|.|.|.::...:||:.:... .|....|||.:| ....
  Fly   159 MQMVVFGWGFDNTEVEIP-----SSDPRNVTVTIISIKECRQKFKSP-KIASTSICARQPKNPKQ 217

  Fly   210 CQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDE 261
            |..|.|.||: |..|     |.|:||:|..|.:.:.||:|||:...:.:|.|
  Fly   218 CLYDGGSPLI-YGRE-----LCGVVSFGSHCIDTSRPGMYTNIRRVKRFITE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 60/243 (25%)
Tryp_SPc 28..262 CDD:238113 61/246 (25%)
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 60/243 (25%)
Tryp_SPc 55..261 CDD:304450 60/243 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.