DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG15498

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster


Alignment Length:93 Identity:24/93 - (25%)
Similarity:33/93 - (35%) Gaps:26/93 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 GHVLSLRRVIAHGDYNPQSHDNDLALLI-------------LNGQLNFTEHLQPVPLAALAD--- 140
            |.|:.:|.| ..|....|..|.:|.|.:             :|...:.|  :.|.|..||.:   
  Fly    62 GVVVQIRPV-KIGVCRQQVSDQNLVLSVVITQEGLHRNCKTINEMCDLT--VAPSPRPALRNSFR 123

  Fly   141 --PPTADTRL-QVSGWG----FQAEESA 161
              .|..|.|. |...:|    .||.|.|
  Fly   124 IVSPNEDDRTGQYLAYGEKFRLQALEPA 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 24/93 (26%)
Tryp_SPc 28..262 CDD:238113 24/93 (26%)
CG15498NP_650974.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.