DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG5246

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:250 Identity:75/250 - (30%)
Similarity:122/250 - (48%) Gaps:30/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGEVATIQEFPYQVSV-QLQGRHICGGAIIGIDTVLTAAHCFEDP-------WSSADYTVRV 83
            |::||..:.....|||||: ...|.|:|||:||....:||||||.|.|       ..:.||| |.
  Fly    41 RVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYT-RP 104

  Fly    84 GSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRL 148
            |:.....|..:        |..::..::.||:||:.....:.:.:..||:.||:....|....:|
  Fly   105 GAEYLVDGSKI--------HCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKL 161

  Fly   149 QVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICA-ARPGRDSCQG 212
            .::|||    .:...|.  .|.||:.:|::.::.:.|:........::...:|. .:.|..||.|
  Fly   162 TLTGWG----STKTWGR--YSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHG 220

  Fly   213 DSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQLDARG 267
            |||||||     :....|.|:|:||..|| ..:|.|:.:||.:..||::.:...|
  Fly   221 DSGGPLV-----DANQTLVGVVNWGEACA-IGYPDVFGSVAYYHDWIEQMMTDAG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 72/240 (30%)
Tryp_SPc 28..262 CDD:238113 73/242 (30%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 72/240 (30%)
Tryp_SPc 42..263 CDD:238113 73/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.