DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG5246

DIOPT Version :10

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:110 Identity:24/110 - (21%)
Similarity:43/110 - (39%) Gaps:34/110 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 YGSQSGNSINNYHGVFDGSAAETGTPPLLDLSEFPSLTNARGGQNDQSLPQSNALQPPGSKPYVG 149
            |.|.:.::.|  |...|         .|.|::...|:|||....|...:...|            
  Fly   721 YDSAAMSNFN--HSFMD---------RLSDIASTKSITNAHSFSNVNEIKVIN------------ 762

  Fly   150 MVKQP--TSEQIAFTMSNEDFPALP--GTQNAEGSQMGAASQGLQ 190
              :||  |::    |.:.|:||..|  |..| :.|::.:.:..::
  Fly   763 --EQPRRTNK----TATPEEFPEFPRGGIDN-DTSEVASIATSIE 800

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 24/110 (22%)
CG5246NP_650603.1 Tryp_SPc 42..263 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.