DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG31266

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:289 Identity:76/289 - (26%)
Similarity:115/289 - (39%) Gaps:69/289 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MALVAYAGAT--------PTPG--------------DGRIVGGEVATIQEFPYQVSVQ-LQGRHI 52
            :.|:|..|.|        |.||              .||::||..|....:|:..|:| ....|:
  Fly    13 LTLLALQGPTEAMRMRGEPLPGLANIERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQNAYSYHL 77

  Fly    53 CGGAIIGIDTVLTAAHCFE--------------DPWS--SADYTVRVGSSEHESGGHVLSLRRVI 101
            ||..|:....|||||.|..              |.|.  :..|||        |..||       
  Fly    78 CGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYAPYYTV--------SQIHV------- 127

  Fly   102 AHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEV 166
             |.:::...:.||:|||.|:.::.|.:..:.:.||.:.:....| :|..:||| .:|.....|..
  Fly   128 -HCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGD-KLTFAGWG-SSEAMGTYGRY 189

  Fly   167 GVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICAAR-PGRDSCQGDSGGPLVGYAAEEGPARL 230
            .......::.||     .||........:....:|... .|:.:|.||:||||:     :...||
  Fly   190 LQEASGTYLPVD-----ACREKLQNQDDVDLGHVCVQMDAGQGACHGDTGGPLI-----DEQQRL 244

  Fly   231 YGIVSWGLGCANPNFPGVYTNVAAFRSWI 259
            .||.:||:.|.. .:|.||...|.:..||
  Fly   245 VGIGNWGVPCGR-GYPDVYARTAFYHDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 66/249 (27%)
Tryp_SPc 28..262 CDD:238113 67/250 (27%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 66/249 (27%)
Tryp_SPc 52..275 CDD:238113 67/250 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.