DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG4053

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:241 Identity:79/241 - (32%)
Similarity:123/241 - (51%) Gaps:25/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DGRIVGGEVATIQEFPYQVSVQ-LQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGSSEH 88
            |.|||||:.|.....|||||:| :...|||.|.|:....:|||.||..| :|..|..:.||:::.
  Fly    32 DNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILTAGHCALD-FSIEDLRIIVGTNDR 95

  Fly    89 ESGGHVLSLRRVIAHGDYN-PQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQVSG 152
            ...|..|.....:.|..|: |..::||:||:.:|..:.|.:..|.|.|:  .:.|.|.:.:.::|
  Fly    96 LEPGQTLFPDEALVHCLYDIPYVYNNDIALIHVNESIIFNDRTQIVELS--REQPPAGSTVTLTG 158

  Fly   153 WGFQAEESAVSGEVGVSPQLRF---VDVDLVESNQCRRAYSQVLPITRRMICA-ARPGRDSCQGD 213
            ||  |.||:.       |.:::   :::.::...:||..:.....|....||. .|.|..:|.||
  Fly   159 WG--APESSY-------PTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTREGEGACSGD 214

  Fly   214 SGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWI 259
            |||||:.    ||  :|.|:|:||..| ....|.:|.|...::.||
  Fly   215 SGGPLMW----EG--KLVGLVNWGRAC-GVGMPDMYANTVYYQDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 76/237 (32%)
Tryp_SPc 28..262 CDD:238113 77/238 (32%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 76/237 (32%)
Tryp_SPc 35..256 CDD:238113 77/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.