DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG17475

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:244 Identity:82/244 - (33%)
Similarity:114/244 - (46%) Gaps:36/244 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGEVATIQEFPYQVSVQ-LQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGSSEHES 90
            |::.||...:.|..||:|:| :.|.|||||.||....|||||||... ::.....|..|:.|:|.
  Fly    49 RVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYG-YNPTYLRVITGTVEYEK 112

  Fly    91 GGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTAD-TRLQVSGWG 154
            ...|..:.....|.:||...:.||:||:.||..:.|.|:.||   |.|...|.|: |:|.::|||
  Fly   113 PDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQP---AELPTAPVANGTQLLLTGWG 174

  Fly   155 FQAEESAVSGEV-GVSPQLRFVDVDLVESNQCRRAYSQVLPITRR-------MICA-ARPGRDSC 210
                    |.|: |.:|.:      |.::......||....|...       .||. ...|:.:|
  Fly   175 --------STELWGDTPDI------LQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGAC 225

  Fly   211 QGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWI 259
            .|||||||.....      |||:|:||..|| ...|..:.||..:..||
  Fly   226 HGDSGGPLTHNGV------LYGLVNWGYPCA-LGVPDSHANVYYYLEWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 80/242 (33%)
Tryp_SPc 28..262 CDD:238113 81/243 (33%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 80/242 (33%)
Tryp_SPc 50..269 CDD:238113 81/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.