DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG10405

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:246 Identity:88/246 - (35%)
Similarity:125/246 - (50%) Gaps:16/246 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFE-DPWSSADYTVR 82
            |.|...|.|||.|..||..:||||:|::.|..||||.:|:..:..:|||||.: ......::|:|
  Fly    28 AVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAAHCIDGHEQQPREFTLR 92

  Fly    83 VGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALL-ILNGQLNF-TEHLQPVPLAALADPPTAD 145
            .||....|||.|..::.:..|..|:....:.|:||| ..:|.|:. ...:.|:.|..:.:..:..
  Fly    93 QGSIMRTSGGTVQPVKAIYKHPAYDRADMNFDVALLRTADGALSLPLGKVAPIRLPTVGEAISES 157

  Fly   146 TRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICAARPGRDSC 210
            ....|||||..:..:.|     :|..|:...|..|...:|.........:|..|.|||....|:|
  Fly   158 MPAVVSGWGHMSTSNPV-----LSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAMFCAAARNTDAC 217

  Fly   211 QGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVA--AFRSWI 259
            |||||||:      .....|.||||||:|||:|.:|||||.:|  ..|.||
  Fly   218 QGDSGGPI------SAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 83/236 (35%)
Tryp_SPc 28..262 CDD:238113 84/237 (35%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 83/236 (35%)
Tryp_SPc 37..263 CDD:238113 84/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443356
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.