DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG12951

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:265 Identity:79/265 - (29%)
Similarity:131/265 - (49%) Gaps:32/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MALVAYAGAT----PTPGDGRIVGGEVATIQEFPYQVSVQ-LQGRHICGGAIIGIDTVLTAAHCF 70
            ::|:.....|    ..|...|:|.|..:::.::|:.||:: ..|.|.|||:||....|:|||||.
  Fly     9 LSLIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCT 73

  Fly    71 EDPWSSAD-YTVRVGSSEHES-GGHVLSLRRVIAHGDYNP-QSHDNDLALLILNGQLNFT-EHLQ 131
            ..  ..|| .:::.|.:...: |.:|:.::::|.|.|::| :.:.||::||::.....|. ..:.
  Fly    74 NG--RPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVA 136

  Fly   132 PVPLAALA-DPPTADTRLQ--VSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQC-RRAYSQV 192
            ||.|.||| ..|.:|..::  :.|||......:      |...|:.|.:.:....:| .|...|.
  Fly   137 PVELPALAFAVPQSDAGVEGVLIGWGLNDTYGS------VQDTLQEVSLKIYSDEECTSRHNGQT 195

  Fly   193 LPITRRMICAA--RPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGL-GCANPNFPGVYTNVAA 254
            .|  :..||..  ..|:..|.|||||||: |..::     .|||||.: .|....:||||..|:.
  Fly   196 DP--KYHICGGVDEGGKGQCSGDSGGPLI-YNGQQ-----VGIVSWSIKPCTVAPYPGVYCKVSQ 252

  Fly   255 FRSWI 259
            :..||
  Fly   253 YVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 74/243 (30%)
Tryp_SPc 28..262 CDD:238113 75/244 (31%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 74/243 (30%)
Tryp_SPc 30..260 CDD:238113 75/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.