DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Try10

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001004097.1 Gene:Try10 / 408247 RGDID:1359400 Length:246 Species:Rattus norvegicus


Alignment Length:263 Identity:92/263 - (34%)
Similarity:134/263 - (50%) Gaps:30/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPW 74
            ::|||..|.|.|...|.:||||........|||||:. .|.|.|||::|....|::||||::   
  Rat     6 ILALVGAAVAFPAADDDKIVGGYTCQENSVPYQVSLN-SGYHFCGGSLINEQWVVSAAHCYK--- 66

  Fly    75 SSADYTVRVGSSEH-----ESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVP 134
              :...||:|  ||     |.....::..::|.|.::..::.:||:.|:.|:..:.....:..|.
  Rat    67 --SRIQVRLG--EHNINVLEGNEQFVNAAKIIKHPNFIRKTLNNDIMLIKLSSPVKLNSRVATVA 127

  Fly   135 LAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRM 199
            |.:...|  |.|:..:||||     :.:|..|.....|:.:|..|:....|..:|..  .||..|
  Rat   128 LPSSCAP--AGTQCLISGWG-----NTLSFGVNEPDLLQCLDAPLLPQADCEASYPG--KITDNM 183

  Fly   200 ICAA--RPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQ 262
            :||.  ..|:||||||||||:|      ....|.||||||.|||.|:.|||||.|..:..||.:.
  Rat   184 VCAGFLEGGKDSCQGDSGGPVV------CNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDT 242

  Fly   263 LDA 265
            :.|
  Rat   243 IAA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 82/238 (34%)
Tryp_SPc 28..262 CDD:238113 84/240 (35%)
Try10NP_001004097.1 Tryp_SPc 23..239 CDD:214473 82/238 (34%)
Tryp_SPc 24..242 CDD:238113 84/240 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.