DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Klk4

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:273 Identity:87/273 - (31%)
Similarity:126/273 - (46%) Gaps:33/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TKFLWWLMALV-AYAGATPTPGDGRIVGGEVATIQEFPYQVSV-QLQGRHICGGAIIGIDTVLTA 66
            |.:.|:|..|: ...|::.:....||:.|:.......|:|.:: .......|.|.::....||:|
  Rat     7 TPWGWFLGYLILEVTGSSASSISSRIIQGQDCLPHSQPWQAALFSEDNAFFCSGVLVHPQWVLSA 71

  Fly    67 AHCFEDPWSSADYTVRVG----SSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFT 127
            |||.:|     .|||.:|    ....|.|..:|.....|.|.:||..|..|||.|:.||..:..:
  Rat    72 AHCIQD-----SYTVGLGLHNLEGSQEPGSRMLEAHLSIQHPNYNDPSFANDLMLIKLNESVMES 131

  Fly   128 EHLQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQ-LRFVDVDLVESNQCRRAYSQ 191
            ..::.:|:|:.. |...||.| |||||....        |..|. |:.|::.:.....||..|..
  Rat   132 NTIRRIPVASQC-PTPGDTCL-VSGWGRLKN--------GKLPSLLQCVNLSVASEETCRLLYDP 186

  Fly   192 VLPITRRMICA-ARPGR-DSCQGDSGGPLVGYAAEEGPARLYGIVSWGLG-CANPNFPGVYTNVA 253
            |..::  |.|| ..|.| |:|.||||||:|...:      |.|:||.|.| |..|..|.||||:.
  Rat   187 VYHLS--MFCAGGGPDRKDTCNGDSGGPIVCNRS------LQGLVSMGQGECGQPGIPSVYTNLC 243

  Fly   254 AFRSWIDEQLDAR 266
            .|.:||...:..|
  Rat   244 KFTNWIWTTIQTR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 79/240 (33%)
Tryp_SPc 28..262 CDD:238113 80/242 (33%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 77/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.