DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG11037

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:249 Identity:81/249 - (32%)
Similarity:128/249 - (51%) Gaps:20/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PTPGDGRIVGGEVATIQEF-PYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVG 84
            |:|.:.|::||.|.|..:. .|..::..:...:|||.::..:.||||||||.....::::.|..|
  Fly    55 PSPHETRVIGGHVTTNAKLGGYLTALLYEDDFVCGGTLLNENIVLTAAHCFLGRMKASEWIVAAG 119

  Fly    85 SSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQ 149
            .|.....|....::..|....:.....:.|:|:::|...|. .:::..:.|.:::..|..:  |.
  Fly   120 ISNLNQKGIRRHVKDFILSEQFREDDMNMDVAVVLLKTPLK-AKNIGTLSLCSVSLKPGVE--LV 181

  Fly   150 VSGWGFQAEESAVSGEVGVSPQ--LRFVDVDLVESNQCRRAYSQVLPITRRMICAARPGR-DSCQ 211
            |||||..|..       |..|.  ||.|.|.::....||.||.....||..|||||..|| |:|.
  Fly   182 VSGWGMTAPR-------GRGPHNLLRTVTVPIIHKKNCRAAYQPTAKITDSMICAAVLGRKDACT 239

  Fly   212 GDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQLDA 265
            .|||||||      ...::.||||:|:|||:..:|||||:|...:.:|::.:.|
  Fly   240 FDSGGPLV------FKKQVCGIVSFGIGCASNRYPGVYTDVMYVKPFIEKSIKA 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 77/235 (33%)
Tryp_SPc 28..262 CDD:238113 77/237 (32%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 77/235 (33%)
Tryp_SPc 62..283 CDD:238113 77/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.