DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG16998

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:258 Identity:96/258 - (37%)
Similarity:139/258 - (53%) Gaps:21/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPW 74
            |:.:..:..:..:|.: |||||....|...|:..|:.:.|.:.|..|:|....::||.||.:.|.
  Fly     8 LLLICGHKTSALSPQE-RIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQYPD 71

  Fly    75 SSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPV--PLAA 137
            |   |:||.||:..:.||...::..||.|.|:|.::.:||:|||.|:.......::|.|  ||.:
  Fly    72 S---YSVRAGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLPLPS 133

  Fly   138 LADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQV-LPITRRMIC 201
            |...|..   |.|:|||   ...|...|  ..|:||...|.::....|:|.||.: .|||..|:|
  Fly   134 LNILPRT---LLVAGWG---NPDATDSE--SEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVC 190

  Fly   202 AARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQLD 264
            ||..|||.|.||||.|||...:.      |||||:..|||:|:||||||.:|.:.:||...|:
  Fly   191 AAGAGRDHCYGDSGAPLVHRGSS------YGIVSFAHGCADPHFPGVYTRLANYVTWIFNVLE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 91/234 (39%)
Tryp_SPc 28..262 CDD:238113 92/236 (39%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 91/234 (39%)
Tryp_SPc 25..242 CDD:238113 90/233 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.