DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG32271

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:269 Identity:92/269 - (34%)
Similarity:132/269 - (49%) Gaps:38/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LWWLMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFE 71
            ||.::.|:....|.....:.|||||....|...||.|::::.|..:|||:::....|:|||||.:
  Fly     4 LWLVLHLIPLCWAASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVK 68

  Fly    72 DPWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLA 136
            ...:|....| .|.:.....|....:.:|.....||.::..:|:|:|.|.              |
  Fly    69 GIGASRILVV-AGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLK--------------A 118

  Fly   137 ALADPPTADTRL-----------QVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYS 190
            .::.|..:...|           :|||||...|.:.     .||.|:|.|||.|:....|...|.
  Fly   119 PISGPKVSTIELCNTSFKAGDLIKVSGWGQITERNK-----AVSMQVRSVDVALIPRKACMSQYK 178

  Fly   191 QVLPITRRMICAARPG-RDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAA 254
            ....||..|.||:.|| :|:|:||||||    |..:|  :|.||||||:|||..:.|||||||..
  Fly   179 LRGTITNTMFCASVPGVKDACEGDSGGP----AVYQG--QLCGIVSWGVGCARKSSPGVYTNVKT 237

  Fly   255 FRSWIDEQL 263
            .||:||:.|
  Fly   238 VRSFIDKAL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 85/243 (35%)
Tryp_SPc 28..262 CDD:238113 86/245 (35%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 85/243 (35%)
Tryp_SPc 25..244 CDD:238113 85/244 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.