DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG3650

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:261 Identity:87/261 - (33%)
Similarity:128/261 - (49%) Gaps:20/261 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYSTKFLWWL-MALVAYAGATPTPGDGRIVGGEVATIQEF-PYQVSVQLQGRHICGGAIIGIDTV 63
            |:...||..| ..|:..|.....|   |||||...|:... .:.|:::..|...|||:::....|
  Fly     1 MWRPLFLLQLTQLLLGLASGQIQP---RIVGGTTTTLSAVGGFVVNLRYDGTFYCGGSLVTSSHV 62

  Fly    64 LTAAHCFEDPWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTE 128
            :|||||.:. :.::..||:.|.|:....|.|..:.|......::..|.:.|:.::.|...|. ..
  Fly    63 VTAAHCLKG-YQASRITVQGGVSKLSQSGVVRRVARYFIPNGFSSSSLNWDVGVIRLQSALT-GS 125

  Fly   129 HLQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVL 193
            .:..:||..:...|  ...::|||||     :...|....|.|||.|.:.|:....|:|||....
  Fly   126 GITTIPLCQVQWNP--GNYMRVSGWG-----TTRYGNSSPSNQLRTVRIQLIRKKVCQRAYQGRD 183

  Fly   194 PITRRMICAARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSW 258
            .:|....||...|:|||.|||||.::      ...:|.|||||||||||..:|||||:|...||:
  Fly   184 TLTASTFCARTGGKDSCSGDSGGGVI------FKNQLCGIVSWGLGCANAQYPGVYTSVHRVRSF 242

  Fly   259 I 259
            |
  Fly   243 I 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 79/232 (34%)
Tryp_SPc 28..262 CDD:238113 79/233 (34%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 79/232 (34%)
Tryp_SPc 26..243 CDD:238113 78/231 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.