DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG32269

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:242 Identity:87/242 - (35%)
Similarity:128/242 - (52%) Gaps:19/242 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRV 83
            ||.:....|||||...||...||.|.:: :|.::|.|::|....|||||||.:. :|::|:|||.
  Fly   100 ATSSKIQSRIVGGTSTTISTTPYIVQLR-RGSNLCSGSLITEQWVLTAAHCVKG-YSASDFTVRG 162

  Fly    84 GSSEHE-SGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALAD-PPTADT 146
            |::..: |.|...|:..:.....:..:..:.|.|||.||..|..|.    :...::.: .|.|.:
  Fly   163 GTTTLDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLTGTN----IGTISMGNYRPKAGS 223

  Fly   147 RLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICAARPGRDSCQ 211
            |::::|||...|     |....|..|:...:.:|...:||:.|.....||:.|:||...|:|||.
  Fly   224 RVRIAGWGVTKE-----GSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCARAAGKDSCS 283

  Fly   212 GDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSW 258
            ||||||:.....      |.||||:|.|||...:|||||.|.|.|.|
  Fly   284 GDSGGPVTRNNT------LLGIVSFGYGCARAGYPGVYTAVVAIRQW 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 85/234 (36%)
Tryp_SPc 28..262 CDD:238113 84/233 (36%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 84/232 (36%)
Tryp_SPc 121..324 CDD:238113 77/219 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.