DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG32270

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:240 Identity:82/240 - (34%)
Similarity:127/240 - (52%) Gaps:17/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGSSEHESG 91
            |||||..:.:...|:.|:::.:|...|||:::....|||||||..| .:.:|:.||.|.:.....
  Fly    30 RIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLND-GNPSDFVVRGGVTYLSDM 93

  Fly    92 GHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQVSGWGFQ 156
            .:...:|:::....|:..:.|:|:|||.|...|. ....:|:.||..:..|.:..|  |||||. 
  Fly    94 RNSRYVRKILMPSAYSRTTLDHDVALLQLKQPLQ-ASIAKPISLAVRSPRPGSFVR--VSGWGL- 154

  Fly   157 AEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICAARPG-RDSCQGDSGGPLVG 220
            .:.|:.|    :..||:.|.|.::...:||..|.....||..|.||:.|| :|:|.||||||:| 
  Fly   155 TDSSSTS----LPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCASVPGLKDACAGDSGGPVV- 214

  Fly   221 YAAEEGPARLYGIVSWGLG--CANPNFPGVYTNVAAFRSWIDEQL 263
                .....|.|:||||..  ||..:.||||::|:....||.:.:
  Fly   215 ----NSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADNI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 80/234 (34%)
Tryp_SPc 28..262 CDD:238113 81/236 (34%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 80/234 (34%)
Tryp_SPc 31..254 CDD:238113 81/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.