DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Prss48

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:261 Identity:93/261 - (35%)
Similarity:136/261 - (52%) Gaps:34/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGS--SEH 88
            ||||||:.|.:..:|:|||::....|.|||::|....|||||||.:..|.|..|:|.:||  .|:
Mouse    38 GRIVGGQDAALGRWPWQVSLRFDYTHSCGGSLISDHWVLTAAHCIKKTWYSFLYSVWLGSIDREY 102

  Fly    89 ESGGHVLSLRRVIAHGDYNPQSH---DNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQV 150
            .|.|....:.|:..     |..|   :.|:|||.|:.::.|:..:.|:.|..::...|......|
Mouse   103 SSTGKEYYVSRIAI-----PDKHRHTEADIALLKLSSRVTFSSVILPICLPNISKQLTVPASCWV 162

  Fly   151 SGWGFQAEESAVSGEVGVSPQ-LRFVDVDLVESNQCRRAYSQV---LP-----ITRRMICAA--R 204
            :|||...|        |..|. |:.::|.::.|..|.:.|:.:   ||     |...|.||.  :
Mouse   163 TGWGQNQE--------GHYPSTLQELEVPVISSEACEQLYNPIGVFLPDLERVIKEDMFCAGERQ 219

  Fly   205 PGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQLDAR--G 267
            ..:|||:|||||||..:.  :|..||.|:|||||.|.. :.|||||||..::.||...:...  |
Mouse   220 SRKDSCKGDSGGPLSCHI--DGVWRLMGVVSWGLECGK-DLPGVYTNVTYYQKWISAIISRAPPG 281

  Fly   268 W 268
            |
Mouse   282 W 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 88/247 (36%)
Tryp_SPc 28..262 CDD:238113 89/249 (36%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 88/247 (36%)
Tryp_SPc 40..274 CDD:238113 89/249 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.