DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG8299

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:250 Identity:94/250 - (37%)
Similarity:145/250 - (57%) Gaps:31/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGEVATIQEFPYQVSVQLQG---RHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGSSEH- 88
            ||||:.|.|.:|||||||:|:.   .|||||:|.....|:|||||.:..::|   .:|:.:.:: 
  Fly    28 IVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYAS---YIRIVAGQNS 89

  Fly    89 -----ESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRL 148
                 |.|   :.:.::|.|..||.:::.||:.|:|....|.::..:||:.:|..|.|..|  :.
  Fly    90 IADLEEQG---VKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAPPSGA--QA 149

  Fly   149 QVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAY-SQVLPITRRMICAA--RPGRDSC 210
            .|||||.:||:     :..:...||.|::.::|.:.|...| ::...:|..|:||.  ..|:|:|
  Fly   150 VVSGWGKRAED-----DEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDTC 209

  Fly   211 QGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQLDA 265
            .|||||||    |.:|.  |.|:||||:||....||||||:|.:...||:||.:|
  Fly   210 NGDSGGPL----AVDGV--LVGVVSWGVGCGREGFPGVYTSVNSHIDWIEEQAEA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 89/242 (37%)
Tryp_SPc 28..262 CDD:238113 91/245 (37%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 89/242 (37%)
Tryp_SPc 28..255 CDD:238113 91/245 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452511
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.