DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Ser8

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:237 Identity:90/237 - (37%)
Similarity:136/237 - (57%) Gaps:19/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGSSEHES 90
            ||||||..::|::.|:|||:|..|.|.|||:||..:.::|||||.:.|.:.::..:|.||::...
  Fly    33 GRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLDTPTTVSNLRIRAGSNKRTY 97

  Fly    91 GGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQVSGWGF 155
            ||.::.:..:.||..||..|..||:.::.|..:|.|...::.:.:|:..  |...:...:|||| 
  Fly    98 GGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASAT--PAHGSAASISGWG- 159

  Fly   156 QAEESAVSGEVGVSPQLRFVDVDLVESNQCRRA---YSQVLPITRRMICAARPGRDSCQGDSGGP 217
               :::..|.  .|..|.|||..:|..:||..:   |...:..|  |||||...:|:||||||||
  Fly   160 ---KTSTDGP--SSATLLFVDTRIVGRSQCGSSTYGYGSFIKAT--MICAAATNKDACQGDSGGP 217

  Fly   218 LVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWI 259
            ||      ...:|.|:||||..||..|:||||.|:|..|.|:
  Fly   218 LV------SGGQLVGVVSWGRDCAVANYPGVYANIAELRDWV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 88/234 (38%)
Tryp_SPc 28..262 CDD:238113 88/235 (37%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 88/234 (38%)
Tryp_SPc 35..253 CDD:238113 87/233 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443277
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.