DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and etaTry

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:281 Identity:100/281 - (35%)
Similarity:149/281 - (53%) Gaps:49/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KFLWWLMALVAYAG--ATPTPGDGRIVGGEVATIQEFPYQVSVQLQGR--------HICGGAIIG 59
            |.:..::|::...|  |.....|||||||  |....:..:..|||:.|        ..|||.|:.
  Fly     3 KVILRILAVLFLLGIYAVSAQSDGRIVGG--ADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILD 65

  Fly    60 IDTVLTAAHCFEDPWSSADYTVRVGSSEHESG--GHVLSLRRVIAHGDYNPQSHDNDLALLILNG 122
            ..|:.|||||..:  ..|:..:.|...:...|  |.|:.:.::|.|..||..:.|||:||:::: 
  Fly    66 AVTIATAAHCVYN--REAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVD- 127

  Fly   123 QLNFTEHLQPVPLAAL---------ADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVD 178
                    .|:||.:.         ::.|....:..:||||: .:|:.:|     |.||:.|.|.
  Fly   128 --------PPLPLDSFSTMEAIEIASEQPAVGVQATISGWGY-TKENGLS-----SDQLQQVKVP 178

  Fly   179 LVESNQCRRAYSQVLPITRRMICA--ARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCA 241
            :|:|.:|:.|| ...||:..|:||  :..|:|:||||||||||  .|.    :|.||||||.|||
  Fly   179 IVDSEKCQEAY-YWRPISEGMLCAGLSEGGKDACQGDSGGPLV--VAN----KLAGIVSWGEGCA 236

  Fly   242 NPNFPGVYTNVAAFRSWIDEQ 262
            .||:||||.|||.::.||.:|
  Fly   237 RPNYPGVYANVAYYKDWIAKQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 91/252 (36%)
Tryp_SPc 28..262 CDD:238113 92/254 (36%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 91/252 (36%)
Tryp_SPc 28..257 CDD:238113 92/254 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.