DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and zetaTry

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster


Alignment Length:285 Identity:106/285 - (37%)
Similarity:152/285 - (53%) Gaps:45/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LWWLMALVAYAGATP--------TPGDGRIVGGEVATIQEFPYQVSVQLQG--------RHICGG 55
            |.:|::|||.....|        :..|||||||....|.:.|||:|::.:|        ||.|||
  Fly    10 LAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGG 74

  Fly    56 AIIGIDTVLTAAHCFEDPWSSADYTVRVGSS-EHESGGHVLSLRRVIAH-GDYNPQSHDNDLALL 118
            :|....|::|||||.....:| .|.|..|:: :..|.|.:.:::.::.| |.|:..:::||:|:|
  Fly    75 SIFNETTIVTAAHCVIGTVAS-QYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAIL 138

  Fly   119 ILNGQL---NFTEHLQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLV 180
            .::..|   |||  ::.:.||  .:.|...|..:|||||..:.....|.      ||..|||.:|
  Fly   139 FVDPPLPLNNFT--IKAIKLA--LEQPIEGTVSKVSGWGTTSPGGYSSN------QLLAVDVPIV 193

  Fly   181 ESNQCRRAY----SQVLPITRRMICAAR---PGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGL 238
            .:..|.:.|    .:...||..|:||.:   .|.|:|||||||||   |..:   .|||:||||.
  Fly   194 SNELCDQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPL---AVRD---ELYGVVSWGN 252

  Fly   239 GCANPNFPGVYTNVAAFRSWIDEQL 263
            .||.||:||||.|||..|.|||..|
  Fly   253 SCALPNYPGVYANVAYLRPWIDAVL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 94/251 (37%)
Tryp_SPc 28..262 CDD:238113 96/253 (38%)
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 94/251 (37%)
Tryp_SPc 39..276 CDD:238113 96/253 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443272
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.