DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and PRSS41

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:312 Identity:90/312 - (28%)
Similarity:138/312 - (44%) Gaps:89/312 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMALVAYAGATPTPGDG-----------------------------RIVGGEVATIQEFPYQVSV 45
            |.||.|..||...||.|                             .:.||..:....:|:|.|:
Human    24 LGALQAGPGAARRPGGGGREGHFLCPAESQEEELLSEACGHREIHALVAGGVESARGRWPWQASL 88

  Fly    46 QLQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVG--------------SSEHESGGHVLS 96
            :|:.||.|||:::....||:|||||:..:..:::||::|              ||.::       
Human    89 RLRRRHRCGGSLLSRRWVLSAAHCFQKHYYPSEWTVQLGELTSRPTPWNLRAYSSRYK------- 146

  Fly    97 LRRVIAHGDYNPQSHD---NDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQVSGWGFQAE 158
            ::.:|.    ||.:..   ||:|||.|...:.:..::||:.:.:............|:|||.   
Human   147 VQDIIV----NPDALGVLRNDIALLRLASSVTYNAYIQPICIESSTFNFVHRPDCWVTGWGL--- 204

  Fly   159 ESAVSGEVGVSP---------QLRFVDVDLVESNQCRRAYSQVLPITRRMI-----CA-ARPGR- 207
                     :||         .||...|.::.:.:|...:.|  |.:|.||     || |..|. 
Human   205 ---------ISPSGTPLPPPYNLREAQVTILNNTRCNYLFEQ--PSSRSMIWDSMFCAGAEDGSV 258

  Fly   208 DSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWI 259
            |:|:||||||||  ..::|.....||||||:.|..||.||||||::.:..||
Human   259 DTCKGDSGGPLV--CDKDGLWYQVGIVSWGMDCGQPNRPGVYTNISVYFHWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 79/264 (30%)
Tryp_SPc 28..262 CDD:238113 81/265 (31%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.