DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Send2

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:266 Identity:90/266 - (33%)
Similarity:133/266 - (50%) Gaps:38/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYSTKFLWWLMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLT 65
            |:...|| .|:||.:.:.......:.||:||:...|:|.|:|||:|..|:|:|||:|...|.::|
  Fly     1 MFIQSFL-LLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIIT 64

  Fly    66 AAHCFEDPWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHL 130
            ||||.:    ...|.||.||:...|.|.|:.:..:..|     :...||:|::.|:..|.||..:
  Fly    65 AAHCVQ----GQGYQVRAGSALKNSNGSVVDVAAIRTH-----EGLGNDIAIVRLSKPLEFTNQV 120

  Fly   131 QPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRF-VDVDLVESNQCRRAYSQVLP 194
            ||:|||....||  .:...|||||..:..|......||:..::: ....|.|.::          
  Fly   121 QPIPLAKTNPPP--GSIAFVSGWGSSSYYSHPIDLQGVNLYIQWPYYCGLTEPSR---------- 173

  Fly   195 ITRRMICAARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGL-GCANPNFPGVYTNVAAFRSW 258
                 |||...||.:|:||||||||      ...:|.|:||.|. .|   .:..:||:|..||.|
  Fly   174 -----ICAGSFGRAACKGDSGGPLV------FDQQLVGVVSGGTKDC---TYSSIYTSVPYFREW 224

  Fly   259 IDEQLD 264
            |...:|
  Fly   225 ILNAID 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 81/233 (35%)
Tryp_SPc 28..262 CDD:238113 82/235 (35%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 81/233 (35%)
Tryp_SPc 27..225 CDD:238113 80/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.