DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Phae1

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:268 Identity:73/268 - (27%)
Similarity:110/268 - (41%) Gaps:40/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPW 74
            |:.:...:|......:||:|||..|.:...||.||:|..|.|.|..:|:..:.::|||||..:..
  Fly    18 LLGICRISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTNSN 82

  Fly    75 SSADYTVRVGSSEHESGGHVLSLRRV---IAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLA 136
            .....|:..||...:........|.:   :.:..|...:...|:.::.......::..:.||.|.
  Fly    83 QVLGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTLP 147

  Fly   137 ALADPPTADTRLQVSGWGFQAEESAVS--GEVGVSPQLRFVDVDLVES------------NQCRR 187
            :....||....|.  |||..:..:..|  ..:.|:..:..:.:...||            |.|..
  Fly   148 SSGVVPTGTANLY--GWGSTSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNLCTG 210

  Fly   188 AYSQVLPITRRMICAARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWG-LGCANPNFPGVYTN 251
                  |:|        .|...|..|||||||     :|.. |.|||||| |.|...|.|.||..
  Fly   211 ------PLT--------GGVSICTSDSGGPLV-----QGNV-LIGIVSWGKLPCGQANSPSVYVQ 255

  Fly   252 VAAFRSWI 259
            |::|.|||
  Fly   256 VSSFISWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 68/249 (27%)
Tryp_SPc 28..262 CDD:238113 69/250 (28%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 68/249 (27%)
Tryp_SPc 36..266 CDD:238113 69/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.