DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and PRSS48

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:250 Identity:87/250 - (34%)
Similarity:132/250 - (52%) Gaps:29/250 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGS-SEHES 90
            |:|||:.|....:|:|||:......||||:::....:||||||.:..|::..|||.:|| :..:|
Human    50 RVVGGQDAAAGRWPWQVSLHFDHNFICGGSLVSERLILTAAHCIQPTWTTFSYTVWLGSITVGDS 114

  Fly    91 GGHV-LSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAA----LADPPTADTRLQV 150
            ...| ..:.:::.|..|  |....|:|||.|:.|:.||..:.|:.|.:    ||.||..    .|
Human   115 RKRVKYYVSKIVIHPKY--QDTTADVALLKLSSQVTFTSAILPICLPSVTKQLAIPPFC----WV 173

  Fly   151 SGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQV---LP-----ITRRMICA--ARP 205
            :|||...|    |.:......|:..:|.:::...|.:.|:.:   ||     |....|||  .:.
Human   174 TGWGKVKE----SSDRDYHSALQEAEVPIIDRQACEQLYNPIGIFLPALEPVIKEDKICAGDTQN 234

  Fly   206 GRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWID 260
            .:|||:|||||||..:.  :|.....|:|||||.|.. :.|||||||..::.||:
Human   235 MKDSCKGDSGGPLSCHI--DGVWIQTGVVSWGLECGK-SLPGVYTNVIYYQKWIN 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 85/247 (34%)
Tryp_SPc 28..262 CDD:238113 86/248 (35%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 85/247 (34%)
Tryp_SPc 51..288 CDD:238113 86/248 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.