DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Try29F

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:246 Identity:111/246 - (45%)
Similarity:140/246 - (56%) Gaps:34/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSSADY--TVRVGSSE 87
            |||||||:||.|::.|||||:| :..|.|||::|....|||||||.|   .||..  .||:|||.
  Fly    39 DGRIVGGQVANIKDIPYQVSLQ-RSYHFCGGSLIAQGWVLTAAHCTE---GSAILLSKVRIGSSR 99

  Fly    88 HESGGHVLSLRRVIAHGDYNPQSHDNDLALLILN--GQLNFTEHLQPVPL--AALADPPTADTRL 148
            ...||.::.::||..|..::..:.|.|.:||.|.  ...|.|:....:|.  |.:||    .|.:
  Fly   100 TSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIAD----GTPV 160

  Fly   149 QVSGWG---FQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICAARP--GRD 208
            .|||||   ...|.|||         ||.|.|..|...||..||.....||.||:||..|  |:|
  Fly   161 LVSGWGNTQSAQETSAV---------LRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKD 216

  Fly   209 SCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWI 259
            :|||||||||    |.:|.  |:|:||||.|||.||:||||:.|:|.|.||
  Fly   217 ACQGDSGGPL----AADGV--LWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 107/242 (44%)
Tryp_SPc 28..262 CDD:238113 108/243 (44%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 107/242 (44%)
Tryp_SPc 42..264 CDD:238113 108/243 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443355
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.