DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and PRSS38

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:286 Identity:96/286 - (33%)
Similarity:140/286 - (48%) Gaps:48/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVG-SSEH 88
            :|:|:||..|..:::|:||||...|.|:|||:|:....||:|||||....:...|.:.|| .:..
Human    57 EGKILGGVPAPERKWPWQVSVHYAGLHVCGGSILNEYWVLSAAHCFHRDKNIKIYDMYVGLVNLR 121

  Fly    89 ESGGHV--LSLRRVIAHGDYNPQSH--DNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQ 149
            .:|.|.  ..:.|||.|..|. ..|  ..|:||:.|..::.|:|.:.||.||      |.:..|.
Human   122 VAGNHTQWYEVNRVILHPTYE-MYHPIGGDVALVQLKTRIVFSESVLPVCLA------TPEVNLT 179

  Fly   150 -----VSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICAA--RPGR 207
                 .:|||..:::...|.|      |:.:.:.|:....|...|..:..|...|:||.  ...:
Human   180 SANCWATGWGLVSKQGETSDE------LQEMQLPLILEPWCHLLYGHMSYIMPDMLCAGDILNAK 238

  Fly   208 DSCQGDSGGPLVGYAAEEGPARL-YGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQLD------- 264
            ..|:||||||||   .|...:.| .||||||.||:||.:||||.:|:.|..||.:.::       
Human   239 TVCEGDSGGPLV---CEFNRSWLQIGIVSWGRGCSNPLYPGVYASVSYFSKWICDNIEITPTPAQ 300

  Fly   265 -------ARG-----WDELLAGWSRL 278
                   |.|     ...:|||||.|
Human   301 PAPALSPALGPTLSVLMAMLAGWSVL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 85/244 (35%)
Tryp_SPc 28..262 CDD:238113 87/246 (35%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 87/246 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4288
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.