DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG31954

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:246 Identity:100/246 - (40%)
Similarity:134/246 - (54%) Gaps:29/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSSAD-YTVRVGSSEH 88
            |||||||....|.:.|:|||:|... |||||:||..:.:||||||...  .:|| ..||:|:||.
  Fly    48 DGRIVGGHRINITDAPHQVSLQTSS-HICGGSIISEEWILTAAHCTYG--KTADRLKVRLGTSEF 109

  Fly    89 ESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQ---- 149
            ...|.:|.:::::.|..:|..:.|.|.:||.|...:.|.|..:.|.|      |.:..:..    
  Fly   110 ARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKL------PESQMKYMDGEA 168

  Fly   150 --VSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICAA--RPGRDSC 210
              ||||| ..:....|.|     .||.|:|.||....|...|.|...:|.|||||.  ..|:|:|
  Fly   169 CFVSGWG-NTQNLLESRE-----WLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKDAC 227

  Fly   211 QGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDE 261
            |||||||:|..:.|     |.|:||||.|||.|::||||:.|:..|.||.|
  Fly   228 QGDSGGPMVSESGE-----LVGVVSWGYGCAKPDYPGVYSRVSFARDWIKE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 95/240 (40%)
Tryp_SPc 28..262 CDD:238113 97/243 (40%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 95/240 (40%)
Tryp_SPc 51..274 CDD:238113 97/243 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443354
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.