DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and prss60.3

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:256 Identity:94/256 - (36%)
Similarity:138/256 - (53%) Gaps:31/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PGDGRIVGGEVATIQEFPYQVSVQ--LQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGS 85
            |.:.|||||..|:...:|:|||:.  ..|.|.|||::|..:.|||||||.... |.....|.:| 
Zfish    31 PLNTRIVGGVNASPGSWPWQVSLHSPKYGGHFCGGSLISSEWVLTAAHCLSGV-SETTLVVYLG- 93

  Fly    86 SEHESGGHVLSLRRVIA----HGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADT 146
            ...:.|.::....|.:|    |..||..::|||:|||.|:..:.||.:::||.|||.....:|.|
Zfish    94 RRTQQGINIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNYIRPVCLAAQNSVYSAGT 158

  Fly   147 RLQVSGWG-FQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICA--ARPGRD 208
            ...::||| .||..:..:..:     |:...:.:|.:::|....... .:|..||||  .:.|:|
Zfish   159 SSWITGWGDIQAGVNLPAPGI-----LQETMIPVVANDRCNALLGSG-TVTNNMICAGLTQGGKD 217

  Fly   209 SCQGDSGGPLVGYAAEEGPARL------YGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQL 263
            :||||||||:|        .||      .||.|||.|||:||.|||||.|:.::|||..::
Zfish   218 TCQGDSGGPMV--------TRLCTVWVQAGITSWGYGCADPNSPGVYTRVSQYQSWISSKI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 91/246 (37%)
Tryp_SPc 28..262 CDD:238113 92/248 (37%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 92/248 (37%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.