DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG11911

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:276 Identity:89/276 - (32%)
Similarity:127/276 - (46%) Gaps:44/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMALVAYA-GA---------TPTPGDGRIVGGEVATIQEFPYQVSV---QLQGRHICGGAIIGID 61
            ::||||.| ||         .|:...|.::.|..|.....||.||:   .|:..|||||.:|..|
  Fly     9 VIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKD 73

  Fly    62 TVLTAAHCFEDPWSSADYTVRVGSSEHESGGHV------LSLRRVI----AHGDYNPQSHDNDLA 116
            .::|||||..:|         ||.| ..:|.|.      |:.:|.:    .|..|.......|:|
  Fly    74 WIVTAAHCISEP---------VGMS-IIAGLHTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIA 128

  Fly   117 LLILNGQLNFTEHLQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVE 181
            ||.:|....|.|.:||..|.:.......:|.|.  ||| |.:....||    :..|:.|...::.
  Fly   129 LLHVNESFIFNEWVQPATLPSREQVHEGETHLY--GWG-QPKSYIFSG----AKTLQTVTTQILN 186

  Fly   182 SNQCRRAYSQVLPITRRMICAA--RPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWG-LGCANP 243
            ..:|:....:..||....||::  :..:.:|.|||||||| ......|:.|.|||||| :.|...
  Fly   187 YEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLV-VEFTNAPSELIGIVSWGYIPCGLA 250

  Fly   244 NFPGVYTNVAAFRSWI 259
            |.|.:||.|:|:..||
  Fly   251 NMPSIYTKVSAYIDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 78/247 (32%)
Tryp_SPc 28..262 CDD:238113 80/248 (32%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 80/248 (32%)
Tryp_SPc 37..266 CDD:214473 78/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.