DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG1304

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:266 Identity:80/266 - (30%)
Similarity:128/266 - (48%) Gaps:26/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WLMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFED- 72
            :|:.|.....:.|...:||:||||.|...:||:|||::..|.|.|||:|:..:.|||||||..: 
  Fly    13 FLLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQ 77

  Fly    73 -------PWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHL 130
                   |.::..:|:|.||::..|||.::.:..||.|.:|.  :..||:|||.|...|..:..:
  Fly    78 DSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYG--NFLNDVALLRLESPLILSASI 140

  Fly   131 QPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPI 195
            ||:.|.. ||.| ||..:.:||||      .:..:..:...|::..:..:...:|.......:..
  Fly   141 QPIDLPT-ADTP-ADVDVIISGWG------RIKHQGDLPRYLQYNTLKSISLERCDELIGWGVQS 197

  Fly   196 TRRMICAARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWID 260
            ...:|..|..|  :|.||||||.| |..:     :.|:..:.......::|..|..|.....||.
  Fly   198 ELCLIHEADNG--ACNGDSGGPAV-YNNQ-----VVGVAGFVWSACGTSYPDGYARVYYHNEWIK 254

  Fly   261 EQLDAR 266
            ...|.:
  Fly   255 NNSDVK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 73/239 (31%)
Tryp_SPc 28..262 CDD:238113 74/241 (31%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 73/239 (31%)
Tryp_SPc 32..256 CDD:238113 74/241 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.