DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG9673

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:268 Identity:75/268 - (27%)
Similarity:127/268 - (47%) Gaps:41/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFED-- 72
            :..|:..|.|:|   .|||:|||.....|:|:..||:....|:|.||||..:.:||||||...  
  Fly    14 IFGLILSAEASP---QGRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVSSVG 75

  Fly    73 --PWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPL 135
              |..::...||:|:....:||.:::::.||.|..|....|  |:|:|.|:..|.|::.:|.:.|
  Fly    76 ITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYGNFLH--DIAILELDETLVFSDRIQDIAL 138

  Fly   136 AALADPPTAD--------TRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCR----RA 188
            ....|..|.|        |.:.|:|||..::.:|       |.:.:..:.:.:..:.|.    ..
  Fly   139 PPTTDEETEDVDAELPNGTPVYVAGWGELSDGTA-------SYKQQKANYNTLSRSLCEWEAGYG 196

  Fly   189 YSQVLPITRRMICAAR-PGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNV 252
            |..|       :|.:| .|...|:||:|..::     :....|.|:.|:..|.....:|.|.|.|
  Fly   197 YESV-------VCLSRAEGEGICRGDAGAAVI-----DDDKVLRGLTSFNFGPCGSKYPDVATRV 249

  Fly   253 AAFRSWID 260
            :.:.:||:
  Fly   250 SYYLTWIE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 68/248 (27%)
Tryp_SPc 28..262 CDD:238113 69/250 (28%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 68/248 (27%)
Tryp_SPc 29..259 CDD:238113 69/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.