DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG33160

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:241 Identity:82/241 - (34%)
Similarity:134/241 - (55%) Gaps:21/241 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGSSEHESG 91
            ||:||.|::|:|..|.|.| .....:|||:::....|:|||||..:. :..|:.: .|.:.:::|
  Fly    33 RIIGGHVSSIKEEKYLVQV-TTSEELCGGSLVKPRWVITAAHCVYNK-NKNDFKI-YGGASNQAG 94

  Fly    92 GH--VLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQVSGWG 154
            .:  :.::..:....|:|.::.:.|:|.|.||..: ...:::.:||||.:.|  |...::|||||
  Fly    95 PYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDM-IGANIETIPLAAQSVP--ARALVKVSGWG 156

  Fly   155 FQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICAAR-PGRDSCQGDSGGPL 218
            |...::..:.|     ::..|.|.:.....|..|:..:..|||.|:|||| ..:|||.|||||||
  Fly   157 FLTADATKTAE-----RVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKKDSCDGDSGGPL 216

  Fly   219 VGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQLD 264
            | |..:     |.||||:|.|||:. .||:||:|...|.|....::
  Fly   217 V-YRGQ-----LAGIVSFGYGCASA-LPGIYTSVPEIRDWFQRVVE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 81/234 (35%)
Tryp_SPc 28..262 CDD:238113 81/236 (34%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 81/233 (35%)
Tryp_SPc 34..253 CDD:238113 81/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.