DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG33159

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:276 Identity:105/276 - (38%)
Similarity:148/276 - (53%) Gaps:37/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYSTKFLWWL--MALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTV 63
            |...:.||||  :|||..:.::.|    |||||:..||.|.||.|.::..|..||||::|....|
  Fly     1 MVGLRLLWWLCHLALVLPSSSSKT----RIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAV 61

  Fly    64 LTAAHCF--EDPWSSADYTVRVGSSEHESGGHVLSLRRVI---AHGDYNPQSHDNDLALLILNGQ 123
            |:||||.  ..|   ..:||..|:|..:....|  :|.|:   ....|:..:.|.|:|||    |
  Fly    62 LSAAHCVYGSQP---EGFTVHAGASRLDQEAPV--VRNVVMFHTSPSYSATNFDMDVALL----Q 117

  Fly   124 LNFTEHLQPVPLAALA---DPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQC 185
            |.....|.|..:|.::   :||..:...::||||...|.:....|     |:|...|.::...:|
  Fly   118 LQEVVVLTPGKVATISPCRNPPEGNAYARISGWGVTRENNREPAE-----QVRTTMVRVLPGAEC 177

  Fly   186 RRAYSQVLPITRRMICAARPG-RDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVY 249
            :.:||....::..|:|||..| ||||.|||||||| |..:     :.||||||.|||.|:|||||
  Fly   178 KISYSGYGQLSDSMLCAAVRGLRDSCSGDSGGPLV-YRGQ-----VCGIVSWGFGCARPSFPGVY 236

  Fly   250 TNVAAFR--SWIDEQL 263
            ||||:.|  .:|::.|
  Fly   237 TNVASERVHEFIEQTL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 94/242 (39%)
Tryp_SPc 28..262 CDD:238113 94/244 (39%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 92/235 (39%)
Tryp_SPc 26..251 CDD:238113 94/244 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.