DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG31269

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:244 Identity:91/244 - (37%)
Similarity:124/244 - (50%) Gaps:32/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DGRIVGGEVATIQEFPYQVSVQ-LQGRHICGGAIIGIDTVLTAAHCFED---PWSSADYTVRVGS 85
            |.||:||:.|.....|||:|:| :.|.|.||||||....|||||||.|:   ||    ..|..|:
  Fly    35 DQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPW----LVVVTGT 95

  Fly    86 SEHESGGHVLSLRRVIAHGDY-NPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQ 149
            :::...|....|:.:..|.:| ||:.| ||:|||.|...:.:.|..||:||..:...|..:..| 
  Fly    96 NKYNQPGGRYFLKAIHIHCNYDNPEMH-NDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVIL- 158

  Fly   150 VSGWGFQAEESAVSGEVGVSP-QLRFVDVDLVESNQCRRAYSQVLPITRRMICA-ARPGRDSCQG 212
             :|||     |.|..  |.|| .|:.:.:..|...:|:...|.........||. :|.|..:|.|
  Fly   159 -TGWG-----STVLW--GTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHG 215

  Fly   213 DSGGPLV--GYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWI 259
            |||||||  ||        |.|:|:||..||. ..|.|:.:|..:|.||
  Fly   216 DSGGPLVSNGY--------LVGLVNWGWPCAT-GVPDVHASVYFYRDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 88/240 (37%)
Tryp_SPc 28..262 CDD:238113 89/241 (37%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 88/240 (37%)
Tryp_SPc 38..258 CDD:238113 89/241 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.