DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG31267

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:252 Identity:74/252 - (29%)
Similarity:119/252 - (47%) Gaps:19/252 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQ-LQGRHICGGAIIGIDTVLTAAHCFEDPWS 75
            |..:....|......||||||.:.:...||.||:| ..|.|.|.|:||....|:|||.|......
  Fly    29 AFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRK 93

  Fly    76 SADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALAD 140
            :....|....:...|.|.:.|:..::.|.:::...:.||:||:..:...::.:..|.:.:|.|.|
  Fly    94 NNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAPLED 158

  Fly   141 PPTADTRLQVSGWGFQAEESAVSGEVG--VSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICA- 202
            ....:| |.:.|:|        |.|:|  .|.||:.:||..|...:|...|.....:....:|| 
  Fly   159 LTDGET-LTMYGYG--------STEIGGDFSWQLQQLDVTYVAPEKCNATYGGTPDLDVGHLCAV 214

  Fly   203 ARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWI 259
            .:.|..:|.||:|||:|     :...||.|:.:||:.|.. .||.|:..::.:.|||
  Fly   215 GKVGAGACHGDTGGPIV-----DSRGRLVGVGNWGVPCGY-GFPDVFARISFYYSWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 70/235 (30%)
Tryp_SPc 28..262 CDD:238113 71/236 (30%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 70/235 (30%)
Tryp_SPc 45..268 CDD:238113 71/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.