DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG32808

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:286 Identity:92/286 - (32%)
Similarity:134/286 - (46%) Gaps:31/286 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WLMALVAYAGAT-----PTPGDGRIVGGEVATIQEFPYQVSVQ--LQGRHICGGAIIGIDTVLTA 66
            ||..|..:..||     .:..||:||.|..|...|||:.||::  ..|||.||..::....||||
  Fly     6 WLARLALFYTATFLLAGASGEDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNPYWVLTA 70

  Fly    67 AHCFEDPWSSADYTVRVGSSE-HESGGHVLSLRRVIAHGDYNPQ-SHDNDLALLILNGQLNFTEH 129
            |||.... |.....::.||.. ..:...|..:..:..|..|.|: .:.||:|||.|...:..::.
  Fly    71 AHCVRGS-SPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSVALSKF 134

  Fly   130 LQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLP 194
            :|||.|.........:....::|||..|     :|.| |...|:.|.:.:....:|...:...|.
  Fly   135 VQPVRLPEPRQVTPGNASAVLAGWGLNA-----TGGV-VQQHLQKVKLQVFSDTECSERHQTYLH 193

  Fly   195 ITRRMICAARP--GRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGL-GCANPNFPGVYTNVAAFR 256
            .::  |||..|  |:..|.|||||||:..    |.....|||||.: .||.|.||||:|.|:|:.
  Fly   194 DSQ--ICAGLPEGGKGQCSGDSGGPLLLI----GSDTQVGIVSWSIKPCARPPFPGVFTEVSAYV 252

  Fly   257 SWIDEQLDARG-----W-DELLAGWS 276
            .||.|.:::..     | .:|:.|.|
  Fly   253 DWIVETVNSYSPPSSLWVGQLIVGRS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 78/238 (33%)
Tryp_SPc 28..262 CDD:238113 80/240 (33%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 78/238 (33%)
Tryp_SPc 30..258 CDD:238113 80/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.