DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG32755

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:292 Identity:102/292 - (34%)
Similarity:146/292 - (50%) Gaps:63/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LWWLMALVA-YAGAT------PTPGDG------RIVGGEVATIQEFPYQVSVQLQG--------R 50
            ||..:.:|| ::|.|      ||....      :||||...||.:.|:||||:.:.        .
  Fly     4 LWMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG 68

  Fly    51 HICGGAIIGIDTVLTAAHC----------FEDPWSSADYTVRVGSSEHESGGHVLS---LRRVIA 102
            |:||||:|....|.:||||          :.||   ..|.|..|||..:.......   ::|::.
  Fly    69 HVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP---ELYVVVAGSSAIDRTDRFTQEYLVQRIVG 130

  Fly   103 HGDYNPQSHDNDLALLILNGQLNF-TEHLQPVPLAALADPPTADTRLQVSGWG--FQAEESAVSG 164
            |.|||..:.:||:|||.|||.:.: :..::.:|||..|  |...|...:.|||  ...|:||   
  Fly   131 HKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKA--PEEGTTCLIHGWGKVTMKEKSA--- 190

  Fly   165 EVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICAA--RPGRDSCQGDSGGPLVGYAAEEGP 227
                  .|:...|.::....|:..|.  ||.::  :||.  :.|.|:|||||||||:      ..
  Fly   191 ------SLQQAPVPILNKELCQVIYK--LPASQ--MCAGFLQGGIDACQGDSGGPLI------CD 239

  Fly   228 ARLYGIVSWGLGCANPNFPGVYTNVAAFRSWI 259
            .||.||:|||:|||:|.:|||||||:.|..||
  Fly   240 GRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 92/257 (36%)
Tryp_SPc 28..262 CDD:238113 94/258 (36%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 92/257 (36%)
Tryp_SPc 38..273 CDD:238113 94/258 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.