DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG32523

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:282 Identity:92/282 - (32%)
Similarity:127/282 - (45%) Gaps:49/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LW---WLMALVAYAGATPTPG------------DGRIVGGEVATIQEFPYQVSVQLQGRHICGGA 56
            :|   |.:.|:...|.....|            :.|||||..|...:||:|:|::|:|.|.|||.
  Fly     1 MWTTLWTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGV 65

  Fly    57 IIGIDTVLTAAHCFE--------DPWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDN 113
            ||....|:||.||.:        |.||     ::.||....|.|..:.:..||.|.:|....| |
  Fly    66 IISATHVITAGHCVKHGNDVVPADLWS-----IQAGSLLLSSDGVRIPVAEVIMHPNYATGGH-N 124

  Fly   114 DLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVD 178
            |||:|.|...|.|..::..:.||. .|||.. ..:.:||||..||:..      :|..|.||.|.
  Fly   125 DLAVLRLQSPLTFDANIAAIQLAT-EDPPNC-VAVDISGWGNIAEKGP------LSDSLLFVQVT 181

  Fly   179 LVESNQCRRAYSQVLPITRRMICAAR-PGRDSCQGDSGGPLVGYAAEEGPARLYGIVS--WGLGC 240
            .:....||..:...||.|  |||... ....:|.||||||     |..| .::.|:.|  .|.||
  Fly   182 SISRGACRWMFYSRLPET--MICLLHSKNSGACYGDSGGP-----ATYG-GKVVGLASLLLGGGC 238

  Fly   241 ANPNFPGVYTNVAAFRSWIDEQ 262
            ... .|..|..::..|:||.|:
  Fly   239 GRA-APDGYLRISKVRAWIAEK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 84/242 (35%)
Tryp_SPc 28..262 CDD:238113 85/244 (35%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 84/242 (35%)
Tryp_SPc 37..219 CDD:238113 71/197 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.