DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG32376

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:263 Identity:96/263 - (36%)
Similarity:134/263 - (50%) Gaps:42/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PTPGDG-------------------RIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTA 66
            |||..|                   |||.|:.....|.|:|.|:..:|..:||..||....:|||
  Fly    40 PTPNFGNISSNPFINALEAQESFPTRIVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKIWILTA 104

  Fly    67 AHCFEDPWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQ 131
            .|||..|  ...|||||||.:...||.:..:::::|...||..:..:|||::.|...:.|.:.::
  Fly   105 HHCFFGP--PEKYTVRVGSDQQRRGGQLRHVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVR 167

  Fly   132 PVPLAALADPPTADTRLQ----VSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQV 192
            ||.|     |.|..|:..    |||||..:..:.     .|...||.|.:|.::.::|::.|.:.
  Fly   168 PVKL-----PSTKTTKFPKKFVVSGWGITSANAQ-----NVQRYLRRVQIDYIKRSKCQKMYKKA 222

  Fly   193 -LPITRRMICAARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFR 256
             |.|.:.||||:|..:|||.|||||||.....      ||||||||:||||.|:||||.|...:.
  Fly   223 GLKIYKDMICASRTNKDSCSGDSGGPLTSRGV------LYGIVSWGIGCANKNYPGVYVNCKRYV 281

  Fly   257 SWI 259
            .||
  Fly   282 PWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 90/236 (38%)
Tryp_SPc 28..262 CDD:238113 91/237 (38%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 90/236 (38%)
Tryp_SPc 66..287 CDD:238113 91/237 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.